BiGG Models

Gene: SBO_2439

Descriptive name:

ptsH

Model:

Position:

Left: 2431633 – Right: 2431890

Strand:

Plus

Chromosome:

DNA Sequence

ATGTTCCAGCAAGAAGTTACCATTACCGCTCCGAACGGTCTGCACACCCGCCCTGCTGCCCAGTTTGTAAAAGAAGCTAAGGGCTTCACTTCTGAAATTACTGTGACTTCCAACGGCAAAAGCGCCAGCGCGAAAAGCCTGTTTAAACTGCAGACTCTGGGCCTGACTCAAGGTACCGTTGTGACTATCTCCGCAGAAGGCGAAGACGAGCAGAAAGCGGTTGAACATCTGGTTAAACTGATGGCGGAACTCGAGTAA

Protein Sequence

MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGKSASAKSLFKLQTLGLTQGTVVTISAEGEDEQKAVEHLVKLMAELE

Associated reactions:

BiGG ID

Name

Gene reaction rule

N-Acetyl-D-glucosamine transport via PEP:Pyr PTS (periplasm)

(SBO_2441 and SBO_1962 and SBO_2439 and SBO_2440) or (SBO_0541 and SBO_2439 and SBO_2440)

N-acetyl-D-mannosamine transport via PTS (periplasm)

SBO_1229 and SBO_1230 and SBO_1231 and SBO_2439 and SBO_2440

N-acetylmuramate transport via PEP:Pyr PTS (periplasm)

SBO_2441 and SBO_2454 and SBO_2439 and SBO_2440

Arbutin transport via PEP:Pyr PTS (periplasm)

SBO_2803 and SBO_2439 and SBO_2440

L-ascorbate transport via PEP:Pyr PTS (periplasm)

SBO_2439 and SBO_2440 and SBO_4260 and SBO_4261 and SBO_4262

Dihydroxyacetone phosphotransferase

SBO_1870 and SBO_1871 and SBO_1872 and SBO_2439 and SBO_2440

Fructose transport via PEP:Pyr PTS (f6p generating) (periplasm)

SBO_1229 and SBO_1230 and SBO_1231 and SBO_2439 and SBO_2440

D-fructose transport via PEP:Pyr PTS (periplasm)

SBO_2157 and SBO_2155 and SBO_2439 and SBO_2440

Galactitol transport via PEP:Pyr PTS (periplasm)

SBO_0915 and SBO_0914 and SBO_0913 and SBO_2439 and SBO_2440

D-glucosamine transport via PEP:Pyr PTS (periplasm)

SBO_1229 and SBO_1230 and SBO_1231 and SBO_2439 and SBO_2440

D-glucose transport via PEP:Pyr PTS (periplasm)

(SBO_2441 and SBO_1513 and SBO_2439 and SBO_2440) or (SBO_2441 and SBO_1962 and SBO_2439 and SBO_2440) or (SBO_1229 and SBO_1230 and SBO_1231 and SBO_2439 and SBO_2440)

Maltose transport via PEP:Pyr PTS (periplasm)

SBO_2441 and SBO_1513 and SBO_2439 and SBO_2440

2-O-alpha-mannosyl-D-glycerate transport via PEP:Pyr PTS (periplasm)

SBO_0589 and SBO_2439 and SBO_2440

D-mannose transport via PEP:Pyr PTS (periplasm)

SBO_1229 and SBO_1230 and SBO_1231 and SBO_2439 and SBO_2440

Mannitol transport via PEP:Pyr PTS (periplasm)

SBO_3597 and SBO_2439 and SBO_2440

D-sorbitol transport via PEP:Pyr PTS (periplasm)

SBO_2439 and SBO_2440 and SBO_2816 and SBO_2814 and SBO_2815

Sucrose transport via PEP:Pyr (periplasm)

SBO_2441 and SBO_2454 and SBO_2439 and SBO_2440

Trehalose transport via PEP:Pyr PTS (periplasm)

SBO_2441 and SBO_2439 and SBO_2440 and SBO_4206

Chitobiose transport via PTS

chbA and SBO_1352 and chbC and SBO_2439 and SBO_2440

Report an error on this page ?

External database links

Old identifiers

SBO_2439