BiGG Models

Gene: PP_5307

Descriptive name:

exbD

Model:

Position:

Left: 6054623 – Right: 6055051

Strand:

Plus

Chromosome:

DNA Sequence

NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN

Protein Sequence

MGLHLNEGGDDLAENHEINVTPFIDVMLVLLIIFMVAAPLATVDIKVDLPASTAKPAPRPEKPVFVSVKADQKLYVGDDQVAAPDQLGPMLDAKTKGDKETTIFFQADKGVDYGDLMEVMNNMRAAGYLKVGLVGLETAAKK

Associated reactions:

BiGG ID

Name

Gene reaction rule

Adenosylcobalimin transport via ton system (extermal)

PP_0525 and (PP_5306 and PP_5307 and PP_5308)

Aerobactin transport via ton system (extracellular)

PP_2193 and (PP_5306 and PP_5307 and PP_5308)

Cobinamide transport via ton system (extermal)

PP_0525 and (PP_5306 and PP_5307 and PP_5308)

Cob(1)alamin transport via ton system (extermal)

PP_0525 and (PP_5306 and PP_5307 and PP_5308)

Carboxymycobactin transport via ton system extracellular

PP_2590 and (PP_5306 and PP_5307 and PP_5308)

Cupper transport via ton system extracellular

PP_4838 and (PP_5306 and PP_5307 and PP_5308)

Ferric-dicitrate transport via ton system (extracellular)

(PP_4613 and (PP_5306 and PP_5307 and PP_5308)) or (PP_0867 and (PP_5306 and PP_5307 and PP_5308))

Ferrypioverdine Pputida specific Ton dependent transport

(PP_0669 and (PP_5306 and PP_5307 and PP_5308)) or (PP_4217 and (PP_5306 and PP_5307 and PP_5308)) or (PP_0535 and (PP_5306 and PP_5307 and PP_5308))

Ferrypioverdine no specific Ton dependent transport

(PP_0669 and (PP_5306 and PP_5307 and PP_5308)) or (PP_4217 and (PP_5306 and PP_5307 and PP_5308)) or (PP_0535 and (PP_5306 and PP_5307 and PP_5308))

Ferrichrome transport via ton system (extracellular)

(PP_0350 and (PP_5306 and PP_5307 and PP_5308)) or (PP_4755 and (PP_5306 and PP_5307 and PP_5308))

Fe-enterobactin transport via ton system (extracellular)

PP_2242 and (PP_5306 and PP_5307 and PP_5308)

Ferroxamine transport via ton system (extracellular)

PP_0160 and (PP_5306 and PP_5307 and PP_5308)

Mycobactin transport via ton system extracellular

PP_2590 and (PP_5306 and PP_5307 and PP_5308)

Heme ton dependend transport system extracellular to periplasm

PP_1006 and (PP_5306 and PP_5307 and PP_5308)

Siroheme ton dependend transport system extracellular to periplasm

PP_1006 and (PP_5306 and PP_5307 and PP_5308)

Report an error on this page ?

External database links

NCBI Entrez Gene: 1042225, 1042225

Provided by MetaNetX (CC BY 4.0)

Old identifiers

PP_5307