BiGG Models

Gene: BSU11330

Descriptive name:

fabHA

Model:

Position:

Left: 1208222 – Right: 1209160

Strand:

Plus

Chromosome:

DNA Sequence

ATGAAAGCTGGAATACTTGGTGTTGGACGTTACATTCCTGAGAAGGTTTTAACAAATCATGATCTTGAAAAAATGGTTGAAACTTCTGACGAGTGGATTCGTACAAGAACAGGAATAGAAGAAAGAAGAATCGCAGCAGATGATGTGTTTTCATCACATATGGCTGTTGCAGCAGCGAAAAATGCGCTGGAACAAGCTGAAGTGGCTGCTGAGGATCTGGATATGATCTTGGTTGCAACTGTTACACCTGATCAGTCATTCCCTACGGTCTCTTGTATGATTCAAGAACAACTCGGCGCGAAGAAAGCGTGTGCTATGGATATCAGCGCGGCTTGTGCGGGCTTCATGTACGGGGTTGTAACCGGTAAACAATTTATTGAATCCGGAACCTACAAGCATGTTCTAGTTGTTGGTGTAGAGAAGCTCTCAAGCATTACCGACTGGGAAGACCGCAATACAGCCGTTCTGTTTGGAGACGGAGCAGGCGCTGCGGTAGTCGGGCCAGTCAGTGATGACAGAGGAATCCTTTCATTTGAACTAGGAGCCGACGGCACAGGCGGTCAGCACTTGTATCTGAATGAAAAACGACATACAATCATGAATGGACGAGAAGTTTTCAAATTTGCAGTCCGCCAAATGGGAGAATCATGCGTAAATGTCATTGAAAAAGCCGGACTTTCAAAAGAGGATGTCGACTTTTTGATTCCGCATCAGGCGAACATCCGTATCATGGAAGCTGCTCGCGAGCGTTTAGAGCTTCCTGTCGAAAAGATGTCTAAAACTGTTCATAAATATGGAAATACTTCTGCCGCATCCATTCCGATCTCTCTTGTAGAAGAATTGGAAGCCGGTAAAATCAAAGACGGCGATGTGGTCGTTATGGTAGGGTTCGGCGGAGGACTAACATGGGGCGCCATTGCAATCCGCTGGGGCCGATAA

Protein Sequence

MKAGILGVGRYIPEKVLTNHDLEKMVETSDEWIRTRTGIEERRIAADDVFSSHMAVAAAKNALEQAEVAAEDLDMILVATVTPDQSFPTVSCMIQEQLGAKKACAMDISAACAGFMYGVVTGKQFIESGTYKHVLVVGVEKLSSITDWEDRNTAVLFGDGAGAAVVGPVSDDRGILSFELGADGTGGQHLYLNEKRHTIMNGREVFKFAVRQMGESCVNVIEKAGLSKEDVDFLIPHQANIRIMEAARERLELPVEKMSKTVHKYGNTSAASIPISLVEELEAGKIKDGDVVVMVGFGGGLTWGAIAIRWGR

Associated reactions:

BiGG ID

Name

Gene reaction rule

B-ketoacyl synthetase (Iso-C14:0)

(BSU15900 and BSU11340 and BSU15910 and BSU11330 and BSU11720 and BSU04030) or (BSU15900 and BSU11340 and BSU15910 and BSU10170 and BSU08650 and BSU36370)

B-ketoacyl synthetase (Anteiso-C17:1)

(BSU15900 and BSU11340 and BSU15910 and BSU11330 and BSU11720 and BSU04030) or (BSU15900 and BSU11340 and BSU15910 and BSU10170 and BSU08650 and BSU36370)

B-ketoacyl synthetase (Iso-C17:0)

(BSU15900 and BSU11340 and BSU15910 and BSU11330 and BSU11720 and BSU04030) or (BSU15900 and BSU11340 and BSU15910 and BSU10170 and BSU08650 and BSU36370)

B-ketoacyl synthetase (octadecanoate)

(BSU15900 and BSU11340 and BSU15910 and BSU11330 and BSU11720 and BSU04030) or (BSU15900 and BSU11340 and BSU15910 and BSU10170 and BSU08650 and BSU36370)

B-ketoacyl synthetase (n-C18:1)

(BSU15900 and BSU11340 and BSU15910 and BSU10170 and BSU08650 and BSU36370) or (BSU15900 and BSU11340 and BSU15910 and BSU11330 and BSU11720 and BSU04030)

B-ketoacyl synthetase (n-C14:0)

(BSU15900 and BSU11340 and BSU15910 and BSU11330 and BSU11720 and BSU04030) or (BSU15900 and BSU11340 and BSU15910 and BSU10170 and BSU08650 and BSU36370)

B-ketoacyl synthetase (Iso-C15:0)

(BSU15900 and BSU11340 and BSU15910 and BSU10170 and BSU08650 and BSU36370) or (BSU15900 and BSU11340 and BSU15910 and BSU11330 and BSU11720 and BSU04030)

B-ketoacyl synthetase (Anteiso-C15:0)

(BSU15900 and BSU11340 and BSU15910 and BSU11330 and BSU11720 and BSU04030) or (BSU15900 and BSU11340 and BSU15910 and BSU10170 and BSU08650 and BSU36370)

B-ketoacyl synthetase (Iso-C16:1)

(BSU15900 and BSU11340 and BSU15910 and BSU10170 and BSU08650 and BSU36370) or (BSU15900 and BSU11340 and BSU15910 and BSU11330 and BSU11720 and BSU04030)

B-ketoacyl synthetase (Iso-C16:0)

(BSU15900 and BSU11340 and BSU15910 and BSU11330 and BSU11720 and BSU04030) or (BSU15900 and BSU11340 and BSU15910 and BSU10170 and BSU08650 and BSU36370)

B-ketoacyl synthetase (n-C16:1)

(BSU15900 and BSU11340 and BSU15910 and BSU11330 and BSU11720 and BSU04030) or (BSU15900 and BSU11340 and BSU15910 and BSU10170 and BSU08650 and BSU36370)

B-ketoacyl synthetase (Iso-C17:1)

(BSU15900 and BSU11340 and BSU15910 and BSU10170 and BSU08650 and BSU36370) or (BSU15900 and BSU11340 and BSU15910 and BSU11330 and BSU11720 and BSU04030)

Report an error on this page ?

External database links

InterPro: IPR004655, IPR013747, IPR013751, IPR016038, IPR016039
SubtiList: BG13127
Gene Ontology Annotation: O34746

Provided by MetaNetX (CC BY 4.0)

Old identifiers

BG13127