BiGG Models

Gene: SF2470

Descriptive name:

ptsH

Model:

Position:

Left: 2531064 – Right: 2531321

Strand:

Plus

Chromosome:

DNA Sequence

ATGTTCCAGCAAGAAGTTACCATTACCGCTCCGAACGGTCTGCACACCCGCCCTGCTGCCCAGTTTGTAAAAGAAGCTAAGGGCTTCACTTCTGAAATTACTGTGACTTCCAACGGCAAAAGCGCCAGCGCGAAAAGCCTGTTTAAACTGCAGACTCTGGGCCTGACTCAAGGTACCGTTGTGACTATCTCCGCAGAAGGCGAAGACGAGCAGAAAGCGGTTGAACATCTGGTTAAACTGATGGCGGAACTCGAGTAA

Protein Sequence

MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGKSASAKSLFKLQTLGLTQGTVVTISAEGEDEQKAVEHLVKLMAELE

Associated reactions:

BiGG ID

Name

Gene reaction rule

N-Acetyl-D-glucosamine transport via PEP:Pyr PTS (periplasm)

(SF2472 and SF1105 and SF2470 and SF2471) or (SF0614 and SF2470 and SF2471)

N-acetyl-D-mannosamine transport via PTS (periplasm)

SF1411 and SF1410 and SF1409 and SF2470 and SF2471

N-acetylmuramate transport via PEP:Pyr PTS (periplasm)

SF2472 and SF2483 and SF2470 and SF2471

Arbutin transport via PEP:Pyr PTS (periplasm)

SF3733 and SF2470 and SF2471

L-ascorbate transport via PEP:Pyr PTS (periplasm)

SF2470 and SF2471 and SF4350 and SF4349 and SF4348

Dihydroxyacetone phosphotransferase

SF1203 and SF1202 and SF1201 and SF2470 and SF2471

Fructose transport via PEP:Pyr PTS (f6p generating) (periplasm)

SF1411 and SF1410 and SF1409 and SF2470 and SF2471

D-fructose transport via PEP:Pyr PTS (periplasm)

SF2252 and SF2254 and SF2470 and SF2471

Galactitol transport via PEP:Pyr PTS (periplasm)

SF2156 and SF2155 and SF2154 and SF2470 and SF2471

D-glucosamine transport via PEP:Pyr PTS (periplasm)

SF1411 and SF1410 and SF1409 and SF2470 and SF2471

D-glucose transport via PEP:Pyr PTS (periplasm)

(SF2472 and SF1645 and SF2470 and SF2471) or (SF2472 and SF1105 and SF2470 and SF2471) or (SF1411 and SF1410 and SF1409 and SF2470 and SF2471)

Maltose transport via PEP:Pyr PTS (periplasm)

SF2472 and SF1645 and SF2470 and SF2471

2-O-alpha-mannosyl-D-glycerate transport via PEP:Pyr PTS (periplasm)

SF0566 and SF2470 and SF2471

D-mannose transport via PEP:Pyr PTS (periplasm)

SF1411 and SF1410 and SF1409 and SF2470 and SF2471

Mannitol transport via PEP:Pyr PTS (periplasm)

SF3633 and SF2470 and SF2471

Sucrose transport via PEP:Pyr (periplasm)

SF2472 and SF2483 and SF2470 and SF2471

Trehalose transport via PEP:Pyr PTS (periplasm)

SF2472 and SF2470 and SF2471 and SF4250

Chitobiose transport via PTS

SF1490 and SF1488 and SF1489 and SF2470 and SF2471

Report an error on this page ?

External database links

Old identifiers

SF2470