Gene: YML022W


Descriptive name:

APT1

Model:

iND750

Position:

Left: 228937 – Right: 229500

Strand:

Plus

Chromosome:

NC_001145.3

DNA Sequence

ATGTCTATAGCAAGTTATGCCCAAGAGTTGAAGTTGGCTTTACATCAATATCCAAACTTCCCTAGTGAAGGCATTCTCTTCGAAGATTTCTTACCCATTTTCAGGAACCCAGGTCTTTTCCAGAAGTTGATCGATGCTTTCAAACTGCATTTAGAAGAAGCTTTTCCAGAAGTTAAAATTGATTATATCGTCGGGTTGGAATCCCGTGGGTTCTTGTTCGGACCAACTTTAGCTTTGGCCCTAGGTGTTGGTTTCGTTCCAGTCAGGAAGGCAGGTAAGCTACCTGGCGAATGTTTTAAGGCTACGTACGAAAAGGAGTACGGTTCTGATCTTTTTGAGATACAGAAAAACGCTATTCCAGCAGGTTCCAACGTTATCATTGTTGATGACATTATTGCCACTGGTGGTTCTGCTGCTGCAGCCGGCGAATTAGTTGAACAACTCGAAGCCAACCTTTTGGAATATAACTTTGTTATGGAGTTGGATTTCTTGAAAGGCAGGAGTAAGTTGAATGCTCCAGTGTTCACTTTACTGAACGCTCAAAAGGAAGCGTTGAAAAAATGA

Protein Sequence

MSIASYAQELKLALHQYPNFPSEGILFEDFLPIFRNPGLFQKLIDAFKLHLEEAFPEVKIDYIVGLESRGFLFGPTLALALGVGFVPVRKAGKLPGECFKATYEKEYGSDLFEIQKNAIPAGSNVIIVDDIIATGGSAAAAGELVEQLEANLLEYNFVMELDFLKGRSKLNAPVFTLLNAQKEALKK

Associated reactions:

BiGG ID Name Gene reaction rule
ADPT Adenine phosphoribosyltransferase YML022W or YDR441C

Report an error on this page ?

External database links

Provided by MetaNetX (CC BY 4.0)

Old identifiers

    YML022W

Latest BiGG Models publication:

King ZA, Lu JS, Dräger A, Miller PC, Federowicz S, Lerman JA, Ebrahim A, Palsson BO, and Lewis NE. BiGG Models: A platform for integrating, standardizing, and sharing genome-scale models (2016) Nucleic Acids Research 44(D1):D515-D522. doi:10.1093/nar/gkv1049


Copyright © 2015 The Regents of the University of California.