BiGG Models

Gene: YGR209C

Descriptive name:

TRX2

Model:

Position:

Left: 912913 – Right: 913227

Strand:

Minus

Chromosome:

DNA Sequence

ATGGTCACTCAATTAAAATCCGCTTCTGAATACGACAGTGCTTTAGCATCTGGCGACAAGTTAGTCGTTGTTGACTTTTTTGCCACATGGTGTGGGCCATGTAAAATGATTGCACCAATGATTGAAAAGTTTGCAGAACAATATTCTGACGCTGCTTTTTACAAGTTGGATGTTGATGAAGTCTCAGATGTTGCTCAAAAAGCTGAAGTTTCTTCCATGCCTACCCTAATCTTCTACAAGGGCGGTAAGGAGGTTACCAGAGTCGTCGGTGCCAACCCAGCTGCTATCAAGCAAGCTATTGCTTCCAACGTATAG

Protein Sequence

MVTQLKSASEYDSALASGDKLVVVDFFATWCGPCKMIAPMIEKFAEQYSDAAFYKLDVDEVSDVAQKAEVSSMPTLIFYKGGKEVTRVVGANPAAIKQAIASNV

Associated reactions:

BiGG ID

Name

Gene reaction rule

Phosphoadenylyl-sulfate reductase (thioredoxin)

(YPR167C and YLR043C) or (YPR167C and YGR209C)

Ribonucleoside-diphosphate reductase (ADP)

((YIL066C and YJL026W) and YLR043C) or ((YIL066C and YJL026W) and YGR209C) or ((YER070W and YJL026W) and YLR043C) or ((YER070W and YJL026W) and YGR209C)

Ribonucleoside diphosphate reductase nuclear

((YGR180C and YIL066C) and YLR043C) or ((YGR180C and YIL066C) and YGR209C) or ((YER070W and YGR180C) and YLR043C) or ((YER070W and YGR180C) and YGR209C)

Ribonucleoside-diphosphate reductase (GDP)

((YER070W and YJL026W) and YLR043C) or ((YER070W and YJL026W) and YGR209C)

Ribonucleoside diphosphate reductase GDP nuclear

((YER070W and YGR180C) and YLR043C) or ((YER070W and YGR180C) and YGR209C)

Ribonucleoside-diphosphate reductase (CDP)

((YER070W and YJL026W) and YLR043C) or ((YER070W and YJL026W) and YGR209C)

Ribonucleoside diphosphate reductase CDP nuclear

((YER070W and YGR180C) and YLR043C) or ((YER070W and YGR180C) and YGR209C)

Ribonucleoside-diphosphate reductase (UDP)

((YER070W and YJL026W) and YLR043C) or ((YER070W and YJL026W) and YGR209C)

Ribonucleoside diphosphate reductase UDP nuclear

((YER070W and YGR180C) and YLR043C) or ((YER070W and YGR180C) and YGR209C)

Ribonucleoside triphosphate reductase ATP

YLR043C or YGR209C

Ribonucleoside triphosphate reductase GTP

YLR043C or YGR209C

Ribonucleoside triphosphate reductase CTP

YGR209C or YLR043C

Ribonucleoside triphosphate reductase UTP

YLR043C or YGR209C

Hydrogen peroxide reductase (thioredoxin)

(YLR043C and YDR453C) or (YGR209C and YDR453C)

Thioredoxin nuclear irreversible

(YIL010W and YLR043C) or (YIL010W and YGR209C)

Hydrogen peroxide reductase thioredoxin peroxisomal

(YLR109W and YLR043C) or (YLR109W and YGR209C)

Thioredoxin reductase (NADPH)

(YDR353W and YDR353W) or YLR043C or (YDR353W and YGR209C)

Report an error on this page ?

External database links

NCBI Entrez Gene: 853123
Saccharomyces Genome Database: S000003441

Provided by MetaNetX (CC BY 4.0)

Old identifiers

YGR209C