BiGG Models

Gene: 18103

Descriptive name:

Nme2

Model:

Position:

Left: 93949929 – Right: 93955620

Strand:

Minus

Chromosome:

DNA Sequence

ATGGCCAACCTCGAGCGTACCTTCATTGCCATCAAGCCAGATGGCGTGCAGCGCGGCCTGGTGGGCGAGATCATCAAACGGTTCGAGCAGAAGGGGTTCCGCCTGGTGGCCATGAAGTTCCTTCGGGCCTCTGAAGAACACCTGAAGCAGCATTACATCGACCTGAAAGACCGTCCTTTCTTCCCGGGGCTGGTGAAGTACATGAACTCGGGGCCCGTGGTGGCCATGGTCTGGGAGGGGCTCAATGTGGTGAAAACGGGCCGAGTGATGCTGGGGGAGACCAATCCAGCTGATTCAAAACCAGGCACCATCCGTGGGGATTTCTGCATTCAAGTTGGCAGGAACATCATTCATGGCAGTGATTCAGTGGAGAGTGCTGAGAAAGAGATCCATCTGTGGTTTAAGCCCGAAGAACTGATCGACTACAAGTCTTGTGCCCATGACTGGGTGTACGAGTAG

Protein Sequence

MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIHLWFKPEELIDYKSCAHDWVYE

Associated reactions:

BiGG ID

Name

Gene reaction rule

Nucleoside-diphosphate kinase (ATP:GDP)

79059 or 54369 or (18103 and 18102) or 171567 or (18103 and 18102) or 171567

Nucleoside-diphosphate kinase (ATP dIDP)

79059 or (18103 and 18102) or 54369 or 171567 or 171567 or (18103 and 18102)

Nucleoside-diphosphate kinase (ATP:dIDP), nuclear

(18103 and 18102) or (18102 and 18103)

Nucleoside-diphosphate kinase (ATP:GDP), nuclear

(18103 and 18102) or (18102 and 18103)

Nucleoside-diphosphate kinase (ATP:UDP)

79059 or 171567 or (18103 and 18102) or 54369 or (18103 and 18102) or 171567

Nucleoside-diphosphate kinase (ATP:UDP), nuclear

(18103 and 18102) or (18102 and 18103)

Nucleoside-diphosphate kinase (ATP:CDP)

79059 or 171567 or (18103 and 18102) or 171567 or 54369 or (18103 and 18102)

Nucleoside-diphosphate kinase (ATP:CDP),nuclear

(18103 and 18102) or (18102 and 18103)

Nucleoside-diphosphate kinase (ATP:dTDP)

79059 or (18103 and 18102) or 54369 or 171567 or 171567 or (18103 and 18102)

Nucleoside-diphosphate kinase (ATP:dTDP), nuclear

(18103 and 18102) or (18102 and 18103)

Nucleoside-diphosphate kinase (ATP:dGDP)

79059 or (18103 and 18102) or 54369 or 171567 or 171567 or (18103 and 18102)

Nucleoside-diphosphate kinase (ATP:dGDP), nuclear

(18103 and 18102) or (18102 and 18103)

Nucleoside-diphosphate kinase (ATP:dUDP)

79059 or (18103 and 18102) or 54369 or 171567 or 171567 or (18103 and 18102)

Nucleoside-diphosphate kinase (ATP:dUDP), nuclear

(18103 and 18102) or (18102 and 18103)

Nucleoside-diphosphate kinase (ATP:dCDP)

79059 or (18103 and 18102) or 54369 or 171567 or 171567 or (18103 and 18102)

Nucleoside-diphosphate kinase (ATP:dCDP), nuclear

(18103 and 18102) or (18102 and 18103)

Nucleoside-diphosphate kinase (ATP:dADP)

79059 or (18103 and 18102) or 54369 or 171567 or 171567 or (18103 and 18102)

Nucleoside-diphosphate kinase (ATP:dADP), nuclear

(18103 and 18102) or (18102 and 18103)

Nucleoside diphosphate kinase ATPIDP

79059 or (18103 and 18102) or 54369 or 171567 or 171567 or (18103 and 18102)

Nucleoside-diphosphate kinase (ATP:IDP), nuclear

(18103 and 18102) or (18102 and 18103)

Report an error on this page ?

External database links

NCBI Entrez Gene: 18103
CCDS: CCDS25246.1

Provided by MetaNetX (CC BY 4.0)

Old identifiers

18103