BiGG Models

Gene: cpcD

Descriptive name:

cpcD

Model:

Position:

Left: 724094 – Right: 724345

Strand:

Minus

Chromosome:

DNA Sequence

ATGTTAGGTCAATCTTCTTTGGTGGGCTATTCCAATACCCAGGCGGCTAACCGTGTCTTTGTCTATGAAGTCAGTGGACTCCGCCAGACCGATGCCAATGAAAACAGTGCCCACGATATTCGTCGCAGCGGTAGTGTGTTTATCAAAGTTCCCTATGCCCGTATGAATGATGAGATGCGCCGCATTTCCCGTCTGGGGGGAACTATTGTTAACATTCGTCCCTATCAAGCTGACAGCAACGAACAAAACTAG

Protein Sequence

MLGQSSLVGYSNTQAANRVFVYEVSGLRQTDANENSAHDIRRSGSVFIKVPYARMNDEMRRISRLGGTIVNIRPYQADSNEQN

Associated reactions:

BiGG ID

Name

Gene reaction rule

Cytochrome b6/f complex

petA and petB and petC and petC and petC and petD and petE and petG and ssl3803 and petM and ycf6 and cpcA and cpcB and cpcC and cpcC and cpcD and cpcE and cpcF and cpcG and cpcG and apcA and apcB and apcC and apcD and apcE and apcF

Cytochrome b6/f complex periplasm

petA and petB and petC and petC and petC and petD and petE and petG and ssl3803 and petM and ycf6 and cpcA and cpcB and cpcC and cpcC and cpcD and cpcE and cpcF and cpcG and cpcG and apcA and apcB and apcC and apcD and apcE and apcF

Cytochrome b6/f complex

petA and petB and petC and petC and petC and petD and petE and petG and ssl3803 and petM and ycf6 and cpcA and cpcB and cpcC and cpcC and cpcD and cpcE and cpcF and cpcG and cpcG and apcA and apcB and apcC and apcD and apcE and apcF

Cytochrome b6/f complex periplasm

petA and petB and petC and petC and petC and petD and petE and petG and ssl3803 and petM and ycf6 and cpcA and cpcB and cpcC and cpcC and cpcD and cpcE and cpcF and cpcG and cpcG and apcA and apcB and apcC and apcD and apcE and apcF

Report an error on this page ?

External database links

Old identifiers

ssl3093