BiGG Models

Gene: ECSF_2279

Descriptive name:

Model:

Position:

Left: 2473490 – Right: 2473747

Strand:

Plus

Chromosome:

DNA Sequence

ATGTTCCAGCAAGAAGTTACCATTACCGCTCCGAACGGTCTGCACACCCGCCCTGCTGCCCAGTTTGTAAAAGAAGCTAAGGGCTTCACTTCTGAAATTACTGTGACTTCCAACGGCAAAAGCGCCAGCGCGAAAAGCCTGTTTAAACTGCAGACTCTGGGCCTGACTCAAGGTACCGTTGTGACTATCTCCGCAGAAGGCGAAGACGAGCAGAAAGCGGTTGAACATCTGGTTAAACTGATGGCGGAACTCGAGTAA

Protein Sequence

MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGKSASAKSLFKLQTLGLTQGTVVTISAEGEDEQKAVEHLVKLMAELE

Associated reactions:

BiGG ID

Name

Gene reaction rule

N-Acetyl-D-glucosamine transport via PEP:Pyr PTS (periplasm)

(ECSF_2281 and ECSF_1000 and ECSF_2279 and ECSF_2280) or (ECSF_0608 and ECSF_2279 and ECSF_2280)

N-acetyl-D-mannosamine transport via PTS (periplasm)

ECSF_1673 and ECSF_1674 and ECSF_1675 and ECSF_2279 and ECSF_2280

N-acetylmuramate transport via PEP:Pyr PTS (periplasm)

ECSF_2281 and ECSF_2291 and ECSF_2279 and ECSF_2280

Arbutin transport via PEP:Pyr PTS (periplasm)

ECSF_3570 and ECSF_2279 and ECSF_2280

L-ascorbate transport via PEP:Pyr PTS (periplasm)

ECSF_2279 and ECSF_2280 and ECSF_4081 and ECSF_4080 and ECSF_4079

Dihydroxyacetone phosphotransferase

ECSF_1150 and ECSF_1149 and ECSF_1148 and ECSF_2279 and ECSF_2280

Fructose transport via PEP:Pyr PTS (f6p generating) (periplasm)

ECSF_1673 and ECSF_1674 and ECSF_1675 and ECSF_2279 and ECSF_2280

D-fructose transport via PEP:Pyr PTS (periplasm)

ECSF_2048 and ECSF_2050 and ECSF_2279 and ECSF_2280

Galactitol transport via PEP:Pyr PTS (periplasm)

ECSF_1976 and ECSF_1975 and ECSF_1974 and ECSF_2279 and ECSF_2280

D-glucosamine transport via PEP:Pyr PTS (periplasm)

ECSF_1673 and ECSF_1674 and ECSF_1675 and ECSF_2279 and ECSF_2280

D-glucose transport via PEP:Pyr PTS (periplasm)

(ECSF_2281 and ECSF_1482 and ECSF_2279 and ECSF_2280) or (ECSF_2281 and ECSF_1000 and ECSF_2279 and ECSF_2280) or (ECSF_1673 and ECSF_1674 and ECSF_1675 and ECSF_2279 and ECSF_2280)

Maltose transport via PEP:Pyr PTS (periplasm)

ECSF_2281 and ECSF_1482 and ECSF_2279 and ECSF_2280

2-O-alpha-mannosyl-D-glycerate transport via PEP:Pyr PTS (periplasm)

ECSF_0663 and ECSF_2279 and ECSF_2280

D-mannose transport via PEP:Pyr PTS (periplasm)

ECSF_1673 and ECSF_1674 and ECSF_1675 and ECSF_2279 and ECSF_2280

Mannitol transport via PEP:Pyr PTS (periplasm)

ECSF_3431 and ECSF_2279 and ECSF_2280

D-sorbitol transport via PEP:Pyr PTS (periplasm)

ECSF_2279 and ECSF_2280 and ECSF_2496 and ECSF_2498 and ECSF_2497

Sucrose transport via PEP:Pyr (periplasm)

ECSF_2281 and ECSF_2291 and ECSF_2279 and ECSF_2280

Trehalose transport via PEP:Pyr PTS (periplasm)

ECSF_2281 and ECSF_2279 and ECSF_2280 and ECSF_4129

Chitobiose transport via PTS

ECSF_1597 and ECSF_1599 and ECSF_1598 and ECSF_2279 and ECSF_2280

Report an error on this page ?

External database links

Old identifiers

ECSF_2279