BiGG Models

Gene: 100765000

Descriptive name:

Slc25a20

Model:

Position:

Left: 201225 – Right: 223104

Strand:

Plus

Chromosome:

DNA Sequence

ATGGCAGACGAGCCGAAGCCCATCAGTCCGCTTAAGAACCTCCTGGCCGGCGGCTTTGGCGGCATGTGCCTGGTGTTTGTGGGGCACCCCCTGGACACGGTCAAGGTCCGCCTGCAGACGCAACCGCCAAGTTTGCCAGGACAGCCACCTATGTACTCTGGGACCATCGACTGTTTCCGGAAGACTCTTATTAGAGAGGGCATCACAGGGCTGTATCGGGGCATGGCTGCACCCATCATTGGAGTCACCCCTATGTTCGCTGTGTGCTTCTTTGGGTTTGGTTTGGGGAAGAAACTACAGCAGAAATCTCCAGAGGATACACTTAACTACCCACAGCTGTTTGCAGCTGGAATGTTATCTGGTGTGTTCACCACGGGAATCATGACCCCTGGAGAACGGATTAAATGCTTGCTGCAGATTCAGGCTTCTACGGGGGAAACCAAATACACTGGTACCTTGGACTGTGCAAAGAAGCTCTATCAGGAGTTTGGGATCCGTGGCTTCTACAAAGGGACTGTGCTGACCCTCATGCGAGATGTTCCAGCCAGTGGGATGTATTTCATGACATATGAATGGCTTAAAAATCTCTTCACTCCAGAGGGAAAGAGTGTCAGTGACCTCAGTGTACCCCGGATCCTCGTGGCTGGAGGCTTTGCCGGGATCTTCAACTGGGCTGTCGCAATCCCCCCAGATGTGCTCAAGTCTCGATTCCAGACTGCCCCTCCTGGAAAATATCCCCATGGTTTCAGAGACGTGCTGAGAGAGCTGATCCGGGATGAAGGAGTGGCATCCTTGTACAAAGGATTCAATGCAGTAATGATAAGAGCCTTCCCAGCCAATGCAGCCTGTTTCCTTGGCTTTGAAATTGCCATGAAGATCCTTAATTGGATTGTCCCCAACTTGTGA

Protein Sequence

MADEPKPISPLKNLLAGGFGGMCLVFVGHPLDTVKVRLQTQPPSLPGQPPMYSGTIDCFRKTLIREGITGLYRGMAAPIIGVTPMFAVCFFGFGLGKKLQQKSPEDTLNYPQLFAAGMLSGVFTTGIMTPGERIKCLLQIQASTGETKYTGTLDCAKKLYQEFGIRGFYKGTVLTLMRDVPASGMYFMTYEWLKNLFTPEGKSVSDLSVPRILVAGGFAGIFNWAVAIPPDVLKSRFQTAPPGKYPHGFRDVLRELIRDEGVASLYKGFNAVMIRAFPANAACFLGFEIAMKILNWIVPNL

Associated reactions:

BiGG ID

Name

Gene reaction rule

O acetylcarnintine transport into mitochondria via diffusion

Transport into the mitochondria (carnitine)

Transport into the mitochondria (carnitine)

C160 transport into the mitochondria

C161 transport into the mitochondria

C161 transport into the mitochondria

C180 transport into the mitochondria

C181 transport into the mitochondria

Arachidonic acid transport into the mitochondria

C226 transport into the mitochondria

Beta oxidation of fatty acid

Beta oxidation of fatty acid

C8:0 acylcarnitine transport to mitochondria

Transport into the mitochondria (carnitine)

L carnitine transport out of mitochondria via diffusion

Transport into the mitochondria (carnitine)

Transport into the mitochondria (carnitine)

2,6 dimethylheptanoyl crn transport

4,8 dimethylnonanoyl crn transport

Transport into the mitochondria (carnitine)

Transport into the mitochondria (carnitine)

Transport into the mitochondria (carnitine)

Heptadecanoate transport into the mitochondria

Transport into the mitochondria (carnitine)

Transport into the mitochondria (carnitine)

Transport into the mitochondria (carnitine)

Transport into the mitochondria (carnitine)

Transport into the mitochondria (carnitine)

Malonyl carnitine transport into mitochondria

Transport into the mitochondria (carnitine)

Transport of 11-octadecenoyl carnitine into the mitochondrial matrix

Transport into the mitochondria from cytosol (carnitine)

Pentadecanoate transport into the mitochondria

R group transport into the mitochondria

R group transport into the mitochondria

R group transport into the mitochondria

Transport into the mitochondria (carnitine)

Transport into the mitochondria (carnitine)

Transport into the mitochondria (carnitine)

Transport into the mitochondria (carnitine)

Transport into the mitochondria (carnitine)

Transport into the mitochondria (carnitine)

Report an error on this page ?

External database links

NCBI Entrez Gene: 100765000

Provided by MetaNetX (CC BY 4.0)

Old identifiers

100765000